PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 615aa    MW: 69427.3 Da    PI: 6.3165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021539genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-1867114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd  l ++v+++G g+W+++ r  g++R++k+c++rw ++l
      Lus10021539  67 KGPWTAEEDTVLMEYVRKHGEGNWNAVQRNSGLNRCGKSCRLRWANHL 114
                      79******************************************9986 PP

2Myb_DNA-binding48.91.5e-15120163146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l++++++++G++ W++ a++++ gRt++++k++w++
      Lus10021539 120 KGSFTPQEERLIIELHAKMGNK-WARMANMLP-GRTDNEIKNYWNT 163
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.61662114IPR017930Myb domain
SuperFamilySSF466891.05E-3164161IPR009057Homeodomain-like
SMARTSM007175.3E-1566116IPR001005SANT/Myb domain
PfamPF002498.8E-1667114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-2468121IPR009057Homeodomain-like
CDDcd001673.13E-1169114No hitNo description
PROSITE profilePS5129424.532115169IPR017930Myb domain
SMARTSM007171.6E-16119167IPR001005SANT/Myb domain
PfamPF002495.9E-15120163IPR001005SANT/Myb domain
CDDcd001671.00E-11122163No hitNo description
Gene3DG3DSA:1.10.10.607.0E-25122167IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MISTTNKGEG GLSGFCTSVG GGGEFNAFIN NNNNNDNNNV VENPQELIQK GGKLGINNNG  60
GNCGLKKGPW TAEEDTVLME YVRKHGEGNW NAVQRNSGLN RCGKSCRLRW ANHLRPNLKK  120
GSFTPQEERL IIELHAKMGN KWARMANMLP GRTDNEIKNY WNTRIKRHQR QGLPLYPPDI  180
QPRQCFQTPP DSYHQFPPVT NSFAFQSEAE EQVPHQDASS SINVLPLFEY PQHHQQHQHN  240
HYSDSTPSTP FTFQTQKIDP FSTHVSPIPS PCSISNNNSN NNNNMSHHHI PTLAFLDFSF  300
PRPTPIQQSA NRFKRFASCG DIANSVVETD NNHVPHSHHF PSVSTAPPLP PHHPIHSPNN  360
NNNNITHFRN SHHQPQRLYD NNNNNLLLSS IVSSDQFHQE IQKENEEMCS LLATMSRQLP  420
SNHNYGDVTM LHTGQFNTTQ FDKDSEHDEN NINNMMRMRN KDKAHNILYA TTIANGGSMY  480
GGLLEDLWQE ANANLVVHNN NNLLFMQQGH HDQVNDEDND SFLPPIDQNN NITKTDISDD  540
DELSKLIEDN ETNHLKFCGE GGDQIGSNDP SSVVTTEDRV NFDLHHMFSF LPTTTDLDKP  600
PLKSCSWDNL PEIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31651675106B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.14e-64myb domain protein 101